Lineage for d4ln1a2 (4ln1 A:148-314)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557402Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2557403Protein automated matches [226850] (32 species)
    not a true protein
  7. 2557411Species Bacillus cereus [TaxId:226900] [226735] (2 PDB entries)
  8. 2557412Domain d4ln1a2: 4ln1 A:148-314 [224713]
    Other proteins in same PDB: d4ln1a1, d4ln1a3, d4ln1b1, d4ln1b3, d4ln1c1, d4ln1c3, d4ln1d1, d4ln1d3
    automated match to d2ldba2
    complexed with ca

Details for d4ln1a2

PDB Entry: 4ln1 (more details), 1.9 Å

PDB Description: crystal structure of l-lactate dehydrogenase from bacillus cereus atcc 14579 complexed with calcium, nysgrc target 029452
PDB Compounds: (A:) L-lactate dehydrogenase 1

SCOPe Domain Sequences for d4ln1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ln1a2 d.162.1.0 (A:148-314) automated matches {Bacillus cereus [TaxId: 226900]}
ttldsarfrymlgeyfdigphnihayiigehgdtelpvwshvsvgiqklqtllekdntyn
qedldkifinvrdaayhiierkgatyygigmsllrvtkailndensvltvsaylegqygq
kdvyigvpavlnrggvreilevelsedeelkfdhsvqvlketmapvl

SCOPe Domain Coordinates for d4ln1a2:

Click to download the PDB-style file with coordinates for d4ln1a2.
(The format of our PDB-style files is described here.)

Timeline for d4ln1a2: