PDB entry 4lge

View 4lge on RCSB PDB site
Description: Crystal structure of clAP1 BIR3 bound to T3261256
Class: Ligase/Ligase inhibitor
Keywords: lAP family, 3 BIR repeats, 1 CARD domain, 1 RING-type zinc finger, Ligase-Ligase inhibitor complex
Deposited on 2013-06-27, released 2013-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.164
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lgea_
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lgeb_
  • Heterogens: ZN, 1Y0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4lgeA (A:)
mgsshhhhhhssgenlyfqggssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyy
vgrnddvkcfccdgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgry

    Sequence, based on observed residues (ATOM records): (download) 
    >4lgeA (A:)
isnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgd
dpwvehakwfprceflirmkgqefvdeiqgry

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4lgeB (B:)
mgsshhhhhhssgenlyfqggssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyy
vgrnddvkcfccdgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgry

    Sequence, based on observed residues (ATOM records): (download) 
    >4lgeB (B:)
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqgry