SCOPe 2.08: Domain d4lgea_: 4lge A:

Lineage for d4lgea_ (4lge A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)

8. Domain d4lgea_: 4lge A: [224660]
   automated match to d3mupc_
   complexed with 1y0, zn

Details for d4lgea_

PDB Entry: 4lge, 1.55 Å

PDB Description: Crystal structure of clAP1 BIR3 bound to T3261256

PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d4lgea_:

Sequence; same for both SEQRES and ATOM records:

>d4lgea_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
isnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgd
dpwvehakwfprceflirmkgqefvdeiqgry

Timeline for d4lgea_:

• d4lgea_ first appeared in SCOPe 2.03
  
• d4lgea_ appears in SCOPe 2.07