PDB entry 4las

View 4las on RCSB PDB site
Description: Crystal structures of a therapeutic single chain antibody in the free Form and in complex with amphetamine and 4-hydroxymethamphetamine
Class: immune system
Keywords: methamphetamine, anti-methamphetamine antibody, therapeutic antibody, scFv, IMMUNE SYSTEM
Deposited on 2013-06-20, released 2013-12-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.164
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Single heavy chain Variable fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LAS (0-116)
    Domains in SCOPe 2.04: d4lash_
  • Chain 'L':
    Compound: Single light chain Variable fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LAS (5-114)
    Domains in SCOPe 2.04: d4lasl_
  • Heterogens: 1WF, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lasH (H:)
    evqlqesgpslvkpsqtlsltcsvtgdsvtsgywswirqfpgnkldymgyisyrgstyyn
    pslksrisitrdtsknqvylqlksvssedtatyycsyfdsddyameywgqgtsvtvs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lasL (L:)
    ggggsqivltqspaimsaspgekvtltcsasssvssshlywyqqkpgsspklwiystsnl
    asgvparfsgsgsgtsysltissmeaedaasyfchqwssfpftfgsgtkleikra