PDB entry 4kt1

View 4kt1 on RCSB PDB site
Description: Complex of R-spondin 1 with LGR4 extracellular domain
Class: hormone receptor/cell adhesion
Keywords: R-spondin, LGR receptor, complex structure, Wnt signaling, HORMONE RECEPTOR-CELL ADHESION complex
Deposited on 2013-05-19, released 2013-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.163
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucine-rich repeat-containing G-protein coupled receptor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BXB1 (0-501)
      • expression tag (502-503)
  • Chain 'E':
    Compound: r-spondin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: RSPO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kt1e_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4kt1E (E:)
acakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikck
iehceacfshnfctkckeglylhkgrcypa