PDB entry 4k0r

View 4k0r on RCSB PDB site
Description: Crystal structure of mouse Cryptochrome 1
Class: circadian clock protein
Keywords: Rossmann fold, circadian clock protein, phosphorylation
Deposited on 2013-04-04, released 2013-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.194
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cryptochrome-1
    Species: Mus musculus [TaxId:10090]
    Gene: CRY1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k0ra1, d4k0ra2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k0rA (A:)
    mgvnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcle
    dldanlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklatea
    gvevivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmt
    plsddhdekygvpsleelgfdtdglssavwpggetealtrlerhlerkawvanferprmn
    ansllasptglspylrfgclscrlfyfkltdlykkvkknsspplslygqllwreffytaa
    tnnprfdkmegnpicvqipwdknpealakwaegrtgfpwidaimtqlrqegwihhlarha
    vacfltrgdlwisweegmkvfeellldadwsinagswmwlscssffqqffhcycpvgfgr
    rtdpngdyirrylpvlrgfpakyiydpwnapegiqkvakcligvnypkpmvnhaeasrln
    iermkqiyqqlsryrglgllasvpsnsngngglmgyapgenvpscsssgngglmgyapge
    nvpscsggncsqgsgilhyahgdsqqthslkqgrssagtglssgkrpsqeedaqsvgpkv
    qrqssnaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k0rA (A:)
    vnavhwfrkglrlhdnpalkeciqgadtircvyildpvginrwrfllqcledldanlrkl
    nsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagvevivris
    htlydldkiielnggqppltykrfqtlvskmeplempcmtplsddhdekygvpsleelgf
    dtlssavwpggetealtrlerhlerkawvanferprsllasptglspylrfgclscrlfy
    fkltdlykkvkknsspplslygqllwreffytaatnnprfdkmegnpicvqipwdknpea
    lakwaegrtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvfeelll
    dadwsinagswmwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgfpakyiyd
    pwnapegiqkvakcligvnypkpmvnhaeasrlniermkqiyq