PDB entry 4jz3

View 4jz3 on RCSB PDB site
Description: Crystal structure of the chicken c-Src-SH3 domain intertwined dimer
Class: signaling protein
Keywords: beta shandwich, SH3, signaling pathways, SIGNALING PROTEIN
Deposited on 2013-04-02, released 2014-04-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.221
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.06: d4jz3a1, d4jz3a2
  • Heterogens: PGE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jz3A (A:)
    gshmtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jz3A (A:)
    mtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps