PDB entry 4jh3

View 4jh3 on RCSB PDB site
Description: Crystal Structure of FosB from Bacillus cereus with Zinc and Fosfomycin
Class: Transferase
Keywords: Bacillithiol-S-Transferase, Transferase
Deposited on 2013-03-04, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.126
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Metallothiol transferase FosB
  Species: Bacillus cereus [TaxId:222523]
  Gene: fosB, BCE_2111
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q739M9 (0-137)
  Domains in SCOPe 2.07: d4jh3a_
• Chain 'B':
  Compound: Metallothiol transferase FosB
  Species: Bacillus cereus [TaxId:222523]
  Gene: fosB, BCE_2111
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q739M9 (0-137)
  Domains in SCOPe 2.07: d4jh3b_
• Heterogens: ZN, MG, FCN, GOL, FMT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4jh3A (A:)
  mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
  yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
  lqdrlnyyredkphmtfy
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4jh3B (B:)
  mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
  yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
  lqdrlnyyredkphmtfy