PDB entry 4jf8

View 4jf8 on RCSB PDB site
Description: Crystal structure of a TrwG component of type IV secretion system protein from Bartonella birtlesii
Class: protein transport
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, cat scratch fever, secretion, host specific adhesion, PROTEIN TRANSPORT
Deposited on 2013-02-27, released 2014-03-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.155
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TrwG component of type IV secretion system
    Species: Bartonella birtlesii [TaxId:111504]
    Gene: trwG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4jf8a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4jf8A (A:)
mahhhhhhmqpaptplvlrvdnttgavdvisvmrehetsygevvdrywlnqyvlnretyd
ydtiqlnydttallstaavqqefykiyegedardkvlsnkaritvkvrsiqpngrgqatv
rfttqqhdstgavgvkqhqiatigytyvgapmkssdrllnplgfqvtsyrtdpeillnn

    Sequence, based on observed residues (ATOM records): (download) 
    >4jf8A (A:)
hetsygevvdrywlnqyvlnretydydtiqlnydttallstaavqqefykiyegedardk
vlsnkaritvkvrsiqpngrgqatvrfttqqhdstgavgvkqhqiatigytyvgapmkss
drllnplgfqvtsyrtdpeillnn