PDB entry 4je1

View 4je1 on RCSB PDB site
Description: Crystal structure of thiol peroxidase from BURKHOLDERIA CENOCEPACIA J2315
Class: oxidoreductase
Keywords: SSGCID, THIOL PEROXIDASE, Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2013-02-26, released 2013-03-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.152
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable thiol peroxidase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: tpx, BceJ2315_33620, BCAL3424
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4E5V4 (8-174)
      • expression tag (1-7)
  • Chain 'B':
    Compound: Probable thiol peroxidase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: tpx, BceJ2315_33620, BCAL3424
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4je1b_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4je1B (B:)
    mahhhhhhmskvtlggnpidlagtfpavgaqaadfklvgkdladlslasfagkrkvlniv
    psldtptcatstrkfneaassldntvvivvsadlpfaatrfctteglanvvtastfrtgr
    afanaygvdvtsgplngltaravvvldaqdkvihaelvgeikdepnydaalaalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4je1B (B:)
    skvtlggnpidlagtfpavgaqaadfklvgkdladlslasfagkrkvlnivpsldtptca
    tstrkfneaassldntvvivvsadlpfaatrfctteglanvvtastfrtgrafanaygvd
    vtsgplngltaravvvldaqdkvihaelvgeikdepnydaalaalk