PDB entry 4jd1

View 4jd1 on RCSB PDB site
Description: Crystal Structure of Metallothiol Transferase FosB 2 from Bacillus anthracis str. Ames
Class: transferase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Transferase, cytosol, NIAID, National Institute of Allergy and Infectious Diseases, alpha/beta fold
Deposited on 2013-02-22, released 2013-03-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallothiol transferase fosB 2
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS3818, BA_4109, fosB-2, fosB2, GBAA_4109
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81W73 (1-139)
      • expression tag (140-147)
    Domains in SCOPe 2.05: d4jd1a_
  • Chain 'B':
    Compound: Metallothiol transferase fosB 2
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS3818, BA_4109, fosB-2, fosB2, GBAA_4109
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81W73 (1-139)
      • cloning artifact (0)
      • expression tag (140-147)
    Domains in SCOPe 2.05: d4jd1b_
  • Heterogens: ZN, FCN, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4jd1A (A:)
mmlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprne
ikqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtg
tlqnrleyykedkkhmtfyiagenlyfq

    Sequence, based on observed residues (ATOM records): (download) 
    >4jd1A (A:)
mlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprnei
kqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtgt
lqnrleyykedkkhmtfyiagenlyfq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4jd1B (B:)
mmlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprne
ikqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtg
tlqnrleyykedkkhmtfyiagenlyfq