SCOPe 2.05: Domain d4jd1a_: 4jd1 A:

Lineage for d4jd1a_ (4jd1 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (18 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [226573] (3 PDB entries)

8. Domain d4jd1a_: 4jd1 A: [223743]
   automated match to d1npbc_
   complexed with fcn, pge, zn

Details for d4jd1a_

PDB Entry: 4jd1, 1.7 Å

PDB Description: Crystal Structure of Metallothiol Transferase FosB 2 from Bacillus anthracis str. Ames

PDB Compounds: (A:) Metallothiol transferase fosB 2

SCOPe Domain Sequences for d4jd1a_:

Sequence; same for both SEQRES and ATOM records:

>d4jd1a_ d.32.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
mlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprnei
kqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtgt
lqnrleyykedkkhmtfyiagenlyfq

Timeline for d4jd1a_:

• d4jd1a_ first appeared in SCOPe 2.03
  
• d4jd1a_ appears in SCOPe 2.04
  
• d4jd1a_ is called d4jd1a1 in SCOPe 2.06
  
• d4jd1a_ appears in the current release, SCOPe 2.08, called d4jd1a1