PDB entry 4j59

View 4j59 on RCSB PDB site
Description: Human Cyclophilin D Complexed with an Inhibitor
Class: Isomerase/Isomerase Inhibitor
Keywords: Isomerase-Isomerase Inhibitor complex
Deposited on 2013-02-08, released 2014-02-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.153
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-prolyl cis-trans isomerase F, mitochondrial
  Species: Homo sapiens [TaxId:9606]
  Gene: PPIF, CYP3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30405 (0-163)
    • engineered mutation (131)
  Domains in SCOPe 2.04: d4j59a_
• Heterogens: 671, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4j59A (A:)
  gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
  cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
  ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls