PDB entry 4j42

View 4j42 on RCSB PDB site
Description: The crystal structure of a secreted protein EsxB (Mutant Y65F) from Bacillus anthracis str. Sterne
Class: unknown function
Keywords: structural genomics, PSI-Biology, protein structure initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2013-02-06, released 2013-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.163
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Secreted protein EsxB
    Species: Bacillus anthracis [TaxId:260799]
    Gene: Bacillus anthracis, BAS2036, BA_2191, GBAA_2191
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R67
      • engineered mutation (67)
    Domains in SCOPe 2.07: d4j42a_
  • Chain 'B':
    Compound: Secreted protein EsxB
    Species: Bacillus anthracis [TaxId:260799]
    Gene: Bacillus anthracis, BAS2036, BA_2191, GBAA_2191
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R67
      • engineered mutation (67)
    Domains in SCOPe 2.07: d4j42b_
  • Heterogens: FLC, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4j42A (A:)
snamaeikitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgefiq
skqamqqfipilegistdlkriadkfrntdnay

    Sequence, based on observed residues (ATOM records): (download) 
    >4j42A (A:)
kitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgefiqskqamqq
fipilegistdlkriadkfr

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4j42B (B:)
snamaeikitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgefiq
skqamqqfipilegistdlkriadkfrntdnay

    Sequence, based on observed residues (ATOM records): (download) 
    >4j42B (B:)
kitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgefiqskqamqq
fipilegistdlkriadkfrntdna