PDB entry 4iye

View 4iye on RCSB PDB site
Description: Crystal structure of AdTx1 (rho-Da1a) from eastern green mamba (Dendroaspis angusticeps)
Class: toxin
Keywords: Snake three-finger toxin family, Type A muscarinic toxin subfamily, Allosteric antagonist of the alpha-1A adrenergic receptor (ADRA1A), Acts as a relaxant of smooth muscle, alpha-1A adrenergic receptor, g-rhoDa1a K34A, Expressed by the venom gland, TOXIN
Deposited on 2013-01-28, released 2013-05-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.174
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Toxin AdTx1
  Species: Dendroaspis angusticeps [TaxId:8618]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P85092 (1-65)
    • expression tag (0)
    • engineered mutation (34)
  Domains in SCOPe 2.04: d4iyea_
• Heterogens: EDO, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4iyeA (A:)
  gltcvtsksifgittedcpdgqnlcfkrrhyvvpaiydstrgcaatcpipenydsihcck
  tdkcne