PDB entry 4iwt

View 4iwt on RCSB PDB site
Description: Crystal structure of the C-teminal choline-binding domain of the Streptococcus pneumoniae prophage LytA
Class: hydrolase
Keywords: solenoid fold, LytA autolysin, Peptidoglycan lysis, Virulence factor, choline-binding domain, HYDROLASE
Deposited on 2013-01-24, released 2014-01-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.202
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lytic amidase
    Species: Streptococcus pneumoniae [TaxId:1105119]
    Gene: LYTA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4iwta_
  • Chain 'B':
    Compound: Lytic amidase
    Species: Streptococcus pneumoniae [TaxId:1105119]
    Gene: LYTA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4iwtb_
  • Heterogens: CHT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4iwtA (A:)
saatgwqkngtgywyvhsdgsypkdkfekingtwyyfdgsgymlsdrwkkhtdgnwyyfd
qsgematgwkkiadkwyyfdvegamktgwvkykdtwyyldakegamvsnafiqsadgtgw
yylkpdgtladkpeftvepdglitvk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4iwtB (B:)
saatgwqkngtgywyvhsdgsypkdkfekingtwyyfdgsgymlsdrwkkhtdgnwyyfd
qsgematgwkkiadkwyyfdvegamktgwvkykdtwyyldakegamvsnafiqsadgtgw
yylkpdgtladkpeftvepdglitvk