PDB entry 4ipx

View 4ipx on RCSB PDB site
Description: Analyzing the visible conformational substates of the FK506 binding protein FKBP12
Class: isomerase
Keywords: isomerase
Deposited on 2013-01-10, released 2013-06-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.207
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-prolyl cis-trans isomerase FKBP1A
  Species: Homo sapiens [TaxId:9606]
  Gene: FKBP1A, FKBP1, FKBP12
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62942 (0-106)
    • engineered mutation (21)
    • engineered mutation (86)
  Domains in SCOPe 2.02: d4ipxa_
• Heterogens: MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ipxA (A:)
  gvqvetispgdgrtfpkrgqtvvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
  egvaqmsvgqrakltispdyaygatgvpgiipphatlvfdvellkle