PDB entry 4ip1

View 4ip1 on RCSB PDB site
Description: C-terminal domain of the thiol:disulfide interchange protein DsbD, Q488K mutant
Class: oxidoreductase
Keywords: thioredoxin, thiol:disulfide oxidoreductase, bacterial periplasm, OXIDOREDUCTASE
Deposited on 2013-01-09, released 2013-12-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.196
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Escherichia coli [TaxId:83333]
    Gene: dsbD, cutA2, cycZ, dipZ, b4136, JW5734
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36655 (Start-123)
      • engineered mutation (65)
      • expression tag (124-125)
    Domains in SCOPe 2.04: d4ip1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4ip1A (A:)
mdtqthlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkala
dtvllkanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlr
drqpglvprgsg

    Sequence, based on observed residues (ATOM records): (download) 
    >4ip1A (A:)
hlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvll
kanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrqpg
l