PDB entry 4im9

View 4im9 on RCSB PDB site
Description: Cystal structure of DnaG primase C-terminal domain from Vibrio cholerae
Class: transferase
Keywords: helicase-primase complex, DNA replication, Hair pin helix, transferase, helicase binding
Deposited on 2013-01-02, released 2014-05-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.229
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA primase
    Species: Vibrio cholerae [TaxId:345073]
    Gene: C-terminal domain, dnaG, Primase, VC395_0535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4im9a_
  • Chain 'B':
    Compound: DNA primase
    Species: Vibrio cholerae [TaxId:345073]
    Gene: C-terminal domain, dnaG, Primase, VC395_0535
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3LX44 (Start-143)
      • expression tag (144-147)
  • Chain 'C':
    Compound: DNA primase
    Species: Vibrio cholerae [TaxId:345073]
    Gene: C-terminal domain, dnaG, Primase, VC395_0535
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3LX44 (Start-143)
      • expression tag (144)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4im9A (A:)
nrpaphkaikrtpmrdvialliqnpsyaelvpdlasvrhlmipgldtfsevlekcrqyph
ittgqllehwrdsknetllsrlasweiplvednqeelfldsldkilaqcvekqienlqak
ersvglsteekrelqdlilkglkalehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4im9A (A:)
tpmrdvialliqnpsyaelvpdlasvrhlmipgldtfsevlekcrqyphittgqllehwr
dsknetllsrlasweiplvednqeelfldsldkilaqcvekqienlqakersvglsteek
relqdlilkglk

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.