PDB entry 4igh

View 4igh on RCSB PDB site
Description: High resolution crystal structure of human dihydroorotate dehydrogenase bound with 4-quinoline carboxylic acid analog
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: anti-viral, quinoline-4-carboxylic acid, redox, dehydrogenase, FMN, membrane, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2012-12-17, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.138
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase (quinone), mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: DHODH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4igha_
  • Heterogens: FMN, ORO, 1EA, ZWI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ighA (A:)
    gderfyaehlmptlqglldpesahrlavrftslgllprarfqdsdmlevrvlghkfrnpv
    giaagfdkhgeavdglykmgfgfveigsvtpkpqegnprprvfrlpedqavinrygfnsh
    glsvvehrlrarqqkqakltedglplgvnlgknktsvdaaedyaegvrvlgpladylvvn
    vsspntaglrslqgkaelrrlltkvlqerdglrrvhrpavlvkiapdltsqdkediasvv
    kelgidglivtnttvsrpaglqgalrsetgglsgkplrdlstqtiremyaltqgrvpiig
    vggvssgqdalekiragaslvqlytaltfwgppvvgkvkreleallkeqgfggvtdaiga
    dhrrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ighA (A:)
    derfyaehlmptlqglldpesahrlavrftslgllprqdsdmlevrvlghkfrnpvgiaa
    gfdkhgeavdglykmgfgfveigsvtpkpqegnprprvfrlpedqavinrygfnshglsv
    vehrlrarqqkqakltedglplgvnlgknktsvdaaedyaegvrvlgpladylvvnvssp
    ntaglgkaelrrlltkvlqerdglrrvhrpavlvkiapdltsqdkediasvvkelgidgl
    ivtnttvsrpaglqgalrsetgglsgkplrdlstqtiremyaltqgrvpiigvggvssgq
    dalekiragaslvqlytaltfwgppvvgkvkreleallkeqgfggvtdaigadhrr