PDB entry 4icu

View 4icu on RCSB PDB site
Description: Ubiquitin-like domain of human tubulin folding cofactor E - crystal from A
Class: chaperone
Keywords: Ubiquitin-like domain, tubulin folding cofactor, alpha tubulin, tubulin folding cofactor B, CHAPERONE
Deposited on 2012-12-11, released 2014-06-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.207
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tubulin-specific chaperone E
  Species: Homo sapiens [TaxId:9606]
  Gene: TBCE
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15813 (Start-84)
  Domains in SCOPe 2.04: d4icua_
• Chain 'B':
  Compound: Tubulin-specific chaperone E
  Species: Homo sapiens [TaxId:9606]
  Gene: TBCE
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15813 (Start-84)
• Chain 'C':
  Compound: Tubulin-specific chaperone E
  Species: Homo sapiens [TaxId:9606]
  Gene: TBCE
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15813 (Start-84)
• Chain 'D':
  Compound: Tubulin-specific chaperone E
  Species: Homo sapiens [TaxId:9606]
  Gene: TBCE
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15813 (Start-84)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4icuA (A:)
  nqlltlkikyphqldqkvlekqlpgsmtiqkvkgllsrllkvpvsdlllsyespkkpgre
  ielendlkslqfysvengdcllvrw
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4icuA (A:)
  qlltlkikyphqldqkvlekqlpgsmtiqkvkgllsrllkvpvsdlllsyespkkpgrei
  elendlkslqfysvengdcllvrw
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.