PDB entry 4i3j

View 4i3j on RCSB PDB site
Description: Structures of PR1 intermediate of photoactive yellow prtein E46Q muntant from time-resolved laue crystallography collected AT 14ID APS
Class: luminescent protein
Keywords: photoreceptor, chromophore, photoreceptor protein, receptor, sensory transduction, luminescent protein
Deposited on 2012-11-26, released 2013-03-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.273
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
  Gene: PYP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
    • engineered mutation (45)
  Domains in SCOPe 2.02: d4i3ja_
• Heterogens: HC4

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4i3jA (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv