PDB entry 4i23

View 4i23 on RCSB PDB site
Description: Crystal structure of the wild-type EGFR kinase domain in complex with dacomitinib (soaked)
Class: transferase
Keywords: Kinase domain, Phosphotransfer, ATP binding, TRANSFERASE
Deposited on 2012-11-21, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.229
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i23a_
  • Heterogens: 1C9

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i23A (A:)
    gsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatsp
    kankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqy
    llnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeg
    gkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerl
    pqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspt
    dsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i23A (A:)
    sgeapnqallrilketefkkikvlgsgtvykglwipegekvkipvaikelatspkankei
    ldeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpik
    wmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppic
    tidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpdmddvvdad
    eyli