PDB entry 4hv3

View 4hv3 on RCSB PDB site
Description: Structure of Ricin A chain bound with N-(N-(pterin-7-yl)carbonyl-L-serinyl)-L-tryptophan
Class: hydrolase/hydrolase inhibitor
Keywords: ricin, protein-ligand complex, pterin, hydrolase-hydrolase inhibitor complex, toxin, hydrolase, ribosome-inactivating protein, n-glycosidase
Deposited on 2012-11-05, released 2012-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02879 (1-267)
      • expression tag (0)
    Domains in SCOPe 2.07: d4hv3a1, d4hv3a2
  • Heterogens: 19L, SO4, MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hv3A (A:)
    mifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfil
    velsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfaf
    ggnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaa
    rfqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngsk
    fsvydvsilipiialmvyrcapppssqf