PDB entry 4hug

View 4hug on RCSB PDB site
Description: Structure of 5-chlorouracil modified A:U base pairs
Class: Hydrolase/DNA
Keywords: 5-chloro-2'-deoxyuridine, W-C base pair, Wobble base pair, double helix, Watson-Crick base pairing pattern, Hydrolase-DNA complex
Deposited on 2012-11-02, released 2012-12-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.195
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease H
    Species: Bacillus halodurans [TaxId:272558]
    Gene: rnhA, BH0863
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KEI9 (0-133)
      • engineered mutation (71)
    Domains in SCOPe 2.02: d4huga_
  • Chain 'B':
    Compound: Ribonuclease H
    Species: Bacillus halodurans [TaxId:272558]
    Gene: rnhA, BH0863
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KEI9 (0-End)
      • engineered mutation (71)
  • Chain 'C':
    Compound: DNA (5'-d(*cp*gp*cp*gp*ap*ap*(ucl)p*(ucl)p*cp*gp*cp*g)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*cp*gp*cp*gp*ap*ap*(ucl)p*(ucl)p*cp*gp*cp*g)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*cp*gp*cp*gp*ap*ap*(ucl)p*(ucl)p*cp*gp*cp*g)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*cp*gp*cp*gp*ap*ap*(ucl)p*(ucl)p*cp*gp*cp*g)-3')
  • Heterogens: MG, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hugA (A:)
    eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
    kernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
    wqtdkwgeikadyg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.