PDB entry 4huf

View 4huf on RCSB PDB site
Description: Structure of 5-chlorouracil modified A:U base pair
Class: Hydrolase/DNA
Keywords: 5-chloro-2'-deoxyuridine, W-C base pair, Wobble base pair, double helix, Watson-Crick base pairing pattern, Hydrolase-DNA complex
Deposited on 2012-11-02, released 2012-12-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.228
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease H
  Species: Bacillus halodurans [TaxId:272558]
  Gene: BH0863, rnhA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KEI9 (0-133)
    • engineered mutation (71)
  Domains in SCOPe 2.02: d4hufa_
• Chain 'B':
  Compound: Ribonuclease H
  Species: Bacillus halodurans [TaxId:272558]
  Gene: BH0863, rnhA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KEI9 (0-End)
    • engineered mutation (71)
• Chain 'C':
  Compound: DNA (5'-d(*cp*gp*cp*gp*ap*ap*(ucl)p*tp*cp*gp*cp*g)-3')
  
• Chain 'D':
  Compound: DNA (5'-d(*cp*gp*cp*gp*ap*ap*(ucl)p*tp*cp*gp*cp*g)-3')
  
• Chain 'E':
  Compound: DNA (5'-d(*cp*gp*cp*gp*ap*ap*(ucl)p*tp*cp*gp*cp*g)-3')
  
• Chain 'F':
  Compound: DNA (5'-d(*cp*gp*cp*gp*ap*ap*(ucl)p*tp*cp*gp*cp*g)-3')
  
• Heterogens: GOL, MG, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hufA (A:)
  eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
  kernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
  wqtdkwgeikadyg
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.