PDB entry 4hsl

View 4hsl on RCSB PDB site
Description: 2.00 angstrom x-ray crystal structure of substrate-bound E110A 3-hydroxyanthranilate-3,4-dioxygenase from Cupriavidus metallidurans
Class: oxidoreductase
Keywords: bi-cupin iron-binding, dioxygenase, Oxidoreductase
Deposited on 2012-10-30, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyanthranilate 3,4-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:266264]
    Gene: Cupriavidus metallidurans, nbaC, Rmet_5193
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1LCS4 (0-173)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4hsla_
  • Heterogens: FE2, 3HA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4hslA (A:)
mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclviarqrpagmldg
fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa