PDB entry 4hnq

View 4hnq on RCSB PDB site
Description: Crystal Structure of the mutant Q97A of Vibrio cholerae CheY3
Class: signaling protein
Keywords: Rossmann fold, response regulator, kinase, mutation, SIGNALING PROTEIN
Deposited on 2012-10-21, released 2013-10-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC_2065
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQD5 (1-123)
      • expression tag (0)
      • engineered mutation (92)
    Domains in SCOPe 2.05: d4hnqa_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4hnqA (A:)
anknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmp
gmqgidllkniradeelkhlpvlmitaeakreaiieaaqagvngyivkpftaatlkekld
kife