SCOPe 2.05: Domain d4hnqa_: 4hnq A:

Lineage for d4hnqa_ (4hnq A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (6 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [194701] (5 PDB entries)

8. Domain d4hnqa_: 4hnq A: [228034]
   automated match to d3chya_
   complexed with mg; mutant

Details for d4hnqa_

PDB Entry: 4hnq, 2.4 Å

PDB Description: Crystal Structure of the mutant Q97A of Vibrio cholerae CheY3

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d4hnqa_:

Sequence; same for both SEQRES and ATOM records:

>d4hnqa_ c.23.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
anknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmp
gmqgidllkniradeelkhlpvlmitaeakreaiieaaqagvngyivkpftaatlkekld
kife

Timeline for d4hnqa_:

• d4hnqa_ first appeared in SCOPe 2.03
  
• d4hnqa_ appears in SCOPe 2.04
  
• d4hnqa_ is called d4hnqa1 in SCOPe 2.06
  
• d4hnqa_ appears in the current release, SCOPe 2.08, called d4hnqa1