PDB entry 4hgq

View 4hgq on RCSB PDB site
Description: Crystal structure of E56A mutant of 2-keto-3-deoxy-D-glycero-D-galactonononate-9-phosphate phosphohydrolase from Bacteroides thetaiotaomicron
Class: Transferase, Hydrolase
Keywords: Rossmann Fold, Phosphohydroylase, Transferase, Hydrolase
Deposited on 2012-10-08, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.197
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acylneuraminate cytidylyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (0-163)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d4hgqa_
  • Chain 'B':
    Compound: Acylneuraminate cytidylyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (0-163)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d4hgqb_
  • Chain 'C':
    Compound: Acylneuraminate cytidylyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (0-163)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d4hgqc_
  • Chain 'D':
    Compound: Acylneuraminate cytidylyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (0-163)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d4hgqd_
  • Chain 'E':
    Compound: Acylneuraminate cytidylyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (0-163)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d4hgqe_
  • Chain 'F':
    Compound: Acylneuraminate cytidylyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (0-163)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d4hgqf_
  • Chain 'G':
    Compound: Acylneuraminate cytidylyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (0-163)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d4hgqg_
  • Chain 'H':
    Compound: Acylneuraminate cytidylyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (0-163)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d4hgqh_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hgqA (A:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hgqB (B:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hgqC (C:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hgqD (D:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hgqE (E:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hgqF (F:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hgqG (G:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hgqH (H:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq