Lineage for d4hgqd_ (4hgq D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920301Species Bacteroides thetaiotaomicron [TaxId:226186] [224914] (4 PDB entries)
  8. 2920321Domain d4hgqd_: 4hgq D: [222585]
    automated match to d3nrjl_
    complexed with mg; mutant

Details for d4hgqd_

PDB Entry: 4hgq (more details), 2.28 Å

PDB Description: crystal structure of e56a mutant of 2-keto-3-deoxy-d-glycero-d- galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron
PDB Compounds: (D:) Acylneuraminate cytidylyltransferase

SCOPe Domain Sequences for d4hgqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hgqd_ c.108.1.0 (D:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
asapfyirrlstiflekrggegvfrefvekvlginledfiaviq

SCOPe Domain Coordinates for d4hgqd_:

Click to download the PDB-style file with coordinates for d4hgqd_.
(The format of our PDB-style files is described here.)

Timeline for d4hgqd_: