PDB entry 4h6a

View 4h6a on RCSB PDB site
Description: Crystal Structure of the Allene Oxide Cyclase 2 from Physcomitrella patens
Class: isomerase
Keywords: B-barrel, Oxylipins, fatty acid, metabolites, allene-oxide cyclase activity, ISOMERASE
Deposited on 2012-09-19, released 2012-10-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.202
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: allene oxide cyclase
  Species: Physcomitrella patens subsp. patens [TaxId:145481]
  Gene: aoc2, PHYPADRAFT_158446
  Database cross-references and differences (RAF-indexed):
  • Uniprot A9RB27 (6-193)
    • expression tag (0-5)
• Chain 'B':
  Compound: allene oxide cyclase
  Species: Physcomitrella patens subsp. patens [TaxId:145481]
  Gene: aoc2, PHYPADRAFT_158446
  Database cross-references and differences (RAF-indexed):
  • Uniprot A9RB27 (6-193)
    • expression tag (0-5)
  Domains in SCOPe 2.02: d4h6ab_
• Chain 'C':
  Compound: allene oxide cyclase
  Species: Physcomitrella patens subsp. patens [TaxId:145481]
  Gene: aoc2, PHYPADRAFT_158446
  Database cross-references and differences (RAF-indexed):
  • Uniprot A9RB27 (6-193)
    • expression tag (0-5)
• Chain 'D':
  Compound: allene oxide cyclase
  Species: Physcomitrella patens subsp. patens [TaxId:145481]
  Gene: aoc2, PHYPADRAFT_158446
  Database cross-references and differences (RAF-indexed):
  • Uniprot A9RB27 (6-193)
    • expression tag (0-5)
• Chain 'E':
  Compound: allene oxide cyclase
  Species: Physcomitrella patens subsp. patens [TaxId:145481]
  Gene: aoc2, PHYPADRAFT_158446
  Database cross-references and differences (RAF-indexed):
  • Uniprot A9RB27 (6-193)
    • expression tag (1-5)
• Chain 'F':
  Compound: allene oxide cyclase
  Species: Physcomitrella patens subsp. patens [TaxId:145481]
  Gene: aoc2, PHYPADRAFT_158446
  Database cross-references and differences (RAF-indexed):
  • Uniprot A9RB27 (6-193)
    • expression tag (1-5)
• Heterogens: MPD, IPA, SO4, MRD, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4h6aB (B:)
  ggplgsmgnkvdklagvqelsvyeinerdrgspvilpfggkkdengahanslgdlvpfsn
  kvydgslqrrlgitagictlishnaekkgdryeaqysfyfgdyghisvqgpyityedtel
  vvtggtgifagchgvaklhqiifpvklfytfylqgikklpeelcasvvppspsaepseqa
  kkchpssvapnftn
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4h6aB (B:)
  ggplgsmgnkvdklagvqelsvyeinerdrgspvanslgdlvpfsnkvydgslqrrlgit
  agictlishnaekkgdryeaqysfyfgdyghisvqgpyityedtelvvtggtgifagchg
  vaklhqiifpvklfytfylqgikklpeelcasvvppspsaepseqakkchpssvapnftn
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.