PDB entry 4h2y

View 4h2y on RCSB PDB site
Description: Crystal structure of engineered Bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from Agrobacterium tumefaciens and ATP
Class: ligase
Keywords: Ligase, ATP binding, glycine binding, carrier protein, aminoacyl-tRNA synthetase, seryl-tRNA synthetase
Deposited on 2012-09-13, released 2013-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amino acid--[acyl-carrier-protein] ligase 1
    Species: Bradyrhizobium japonicum [TaxId:224911]
    Gene: bll0957
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Amino acid--[acyl-carrier-protein] ligase 1
    Species: Bradyrhizobium japonicum [TaxId:224911]
    Gene: bll0957
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Aminoacyl carrier protein
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_C_4658, Atu2571
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9CHM9 (20-End)
      • expression tag (19)
    Domains in SCOPe 2.06: d4h2yc1, d4h2yc2
  • Chain 'D':
    Compound: Aminoacyl carrier protein
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_C_4658, Atu2571
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4h2yd_
  • Heterogens: ZN, ATP, MG, PNS, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4h2yC (C:)
    mgsshhhhhhssglvprgshmnatireilakfgqlptpvdtiadeadlyaaglssfasvq
    lmlgieeafdiefpdnllnrksfasikaiedtvklildgkeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h2yC (C:)
    hmnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnlln
    rksfasikaiedtvkli
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4h2yD (D:)
    mgsshhhhhhssglvprgshmnatireilakfgqlptpvdtiadeadlyaaglssfasvq
    lmlgieeafdiefpdnllnrksfasikaiedtvklildgkeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h2yD (D:)
    natireilakfgqlplyaaglssfasvqlmlgieeafdiefpdnllnrksfasikaiedt
    vkl