PDB entry 4gro

View 4gro on RCSB PDB site
Description: Crystallographic and biological characterization of N- and C- terminus mutants of human MIF
Class: cytokine, Isomerase
Keywords: alpha/beta mixture, cytokine, Isomerase
Deposited on 2012-08-26, released 2013-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-116)
      • insertion (1-3)
    Domains in SCOPe 2.06: d4groa_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-116)
      • insertion (1-3)
    Domains in SCOPe 2.06: d4grob_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-116)
      • insertion (1-3)
    Domains in SCOPe 2.06: d4groc_
  • Chain 'D':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-116)
      • insertion (1-3)
    Domains in SCOPe 2.06: d4grod_
  • Chain 'E':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-116)
      • insertion (1-3)
    Domains in SCOPe 2.06: d4groe_
  • Chain 'F':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-116)
      • insertion (1-3)
    Domains in SCOPe 2.06: d4grof_
  • Chain 'G':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-116)
      • insertion (1-3)
    Domains in SCOPe 2.06: d4grog_
  • Chain 'H':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-116)
      • insertion (1-3)
    Domains in SCOPe 2.06: d4groh_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4groA (A:)
    paaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepca
    lcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4groB (B:)
    paaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepca
    lcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4groC (C:)
    paaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepca
    lcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4groD (D:)
    paaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepca
    lcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4groE (E:)
    paaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepca
    lcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4groF (F:)
    paaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepca
    lcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4groG (G:)
    paaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepca
    lcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4groH (H:)
    paaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepca
    lcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa