PDB entry 4gjf

View 4gjf on RCSB PDB site
Description: Crystal structure of the amino-terminal domain of human cardiac troponin C mutant L29Q in complex with cadmium
Class: contractile protein
Keywords: helix-loop-helix ef-hand motif, contractile protein, calcium sensor, cadmium binding
Deposited on 2012-08-09, released 2013-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: troponin c, slow skeletal and cardiac muscles
  Species: Homo sapiens [TaxId:9606]
  Gene: TNNC, TNNC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63316 (0-88)
    • engineered mutation (28)
  Domains in SCOPe 2.07: d4gjfa_
• Heterogens: CA, CD, ACT, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4gjfA (A:)
  mddiykaaveqlteeqknefkaafdifvqgaedgcistkelgkvmrmlgqnptpeelqem
  idevdedgsgtvdfdeflvmmvrcmkdds
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4gjfA (A:)
  mddiykaaveqlteeqknefkaafdifvqgaedgcistkelgkvmrmlgqnptpeelqem
  idevdegtvdfdeflvmmvrcmkdds