PDB entry 4fxc

View 4fxc on RCSB PDB site
Description: tertiary structure of [2fe-2s] ferredoxin from spirulina platensis refined at 2.5 angstroms resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis
Class: electron transport
Keywords: electron transport
Deposited on 1995-04-25, released 1995-12-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fxca_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fxcA (A:)
    atykvtlineaeginetidcdddtyildaaeeagldlpyscragacstcagtitsgtidq
    sdqsfldddqieagyvltcvayptsdctikthqeegly