PDB entry 4fru

View 4fru on RCSB PDB site
Description: Crystal structure of horse wild-type cyclophilin B
Class: isomerase
Keywords: cyclophilin-type PPIase, Peptidyl-prolyl cis-trans isomerase; chaperone; foldase, P3H1-CRTAP-CypB complex; LH1 binding, endoplasmic reticulum, ISOMERASE
Deposited on 2012-06-26, released 2012-11-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.117
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: peptidyl-prolyl cis-trans isomerase
  Species: Equus caballus [TaxId:9796]
  Gene: PPIB
  Database cross-references and differences (RAF-indexed):
  • Uniprot A5YBL8 (2-184)
    • expression tag (0-1)
  Domains in SCOPe 2.04: d4frua_
• Heterogens: ZN, ME2, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4fruA (A:)
  amdekkkgpkvtvkvyfdlrigdedigrvviglfgktvpktvdnfvalatgekgfgykds
  kfhrvikdfmiqggdftrgdgtggksiygerfpdenfklkhygpgwvsmanagkdtngsq
  ffittvktawldgkhvvfgkvlegmevvrkvettktdgrdkplkdvtiadcgkievekpf
  aiake