PDB entry 4fb1
View 4fb1 on RCSB PDB site
Description: Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 60 Days
Class: Oxidoreductase/Electron Transfer
Keywords: trytpophan tryptophylquinone, Oxidoreductase-Electron Transfe complex, Oxidoreductase-Electron Transfer complex
Deposited on
2012-05-22, released
2013-03-27
The last revision prior to the SCOPe 2.02 freeze date was dated
2013-03-27, with a file datestamp of
2013-03-22.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.165
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Methylamine utilization protein MauG
Species: Paracoccus denitrificans [TaxId:318586]
Gene: mauG, Pden_4736
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Methylamine utilization protein MauG
Species: Paracoccus denitrificans [TaxId:318586]
Gene: mauG, Pden_4736
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Methylamine dehydrogenase light chain
Species: Paracoccus denitrificans [TaxId:266]
Gene: mauA
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Methylamine dehydrogenase heavy chain
Species: Paracoccus denitrificans [TaxId:318586]
Gene: Pden_4730
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Methylamine dehydrogenase light chain
Species: Paracoccus denitrificans [TaxId:266]
Gene: mauA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d4fb1e_ - Chain 'F':
Compound: Methylamine dehydrogenase heavy chain
Species: Paracoccus denitrificans [TaxId:318586]
Gene: Pden_4730
Database cross-references and differences (RAF-indexed):
- Heterogens: CA, HEC, NA, MES, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
Sequence, based on SEQRES records: (download)
>4fb1E (E:)
adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
ctispivgkashhhhhh
Sequence, based on observed residues (ATOM records): (download)
>4fb1E (E:)
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas
- Chain 'F':
No sequence available.