PDB entry 4fa9
View 4fa9 on RCSB PDB site
Description: Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 30 Days
Class: Oxidoreductase/Electron transport
Keywords: Tryptophan Tryptophylquinon, Oxidoreductase-Electron transfer complex, Oxidoreductase-Electron transport complex
Deposited on
2012-05-21, released
2013-03-06
The last revision prior to the SCOPe 2.02 freeze date was dated
2013-03-06, with a file datestamp of
2013-03-01.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.159
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Methylamine utilization protein MauG
Species: Paracoccus denitrificans [TaxId:318586]
Gene: mauG, Pden_4736
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Methylamine utilization protein MauG
Species: Paracoccus denitrificans [TaxId:318586]
Gene: mauG, Pden_4736
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Methylamine dehydrogenase light chain
Species: Paracoccus denitrificans [TaxId:266]
Gene: mauA
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Methylamine dehydrogenase heavy chain
Species: Paracoccus denitrificans [TaxId:318586]
Gene: Pden_4730
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Methylamine dehydrogenase light chain
Species: Paracoccus denitrificans [TaxId:266]
Gene: mauA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d4fa9e_ - Chain 'F':
Compound: Methylamine dehydrogenase heavy chain
Species: Paracoccus denitrificans [TaxId:318586]
Gene: Pden_4730
Database cross-references and differences (RAF-indexed):
- Heterogens: CA, HEC, ACT, NA, EDO, PGE, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
Sequence, based on SEQRES records: (download)
>4fa9E (E:)
adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
ctispivgkashhhhhh
Sequence, based on observed residues (ATOM records): (download)
>4fa9E (E:)
gtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynpt
dgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctisp
ivgkas
- Chain 'F':
No sequence available.