PDB entry 4f9k

View 4f9k on RCSB PDB site
Description: Crystal Structure of human cAMP-dependent protein kinase type I-beta regulatory subunit (fragment 11-73), Northeast Structural Genomics Consortium (NESG) Target HR8613A
Class: Transferase Regulator
Keywords: Structural Genomics, PSI-Biology, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Transferase Regulator
Deposited on 2012-05-18, released 2012-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase type I-beta regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4f9ka_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase type I-beta regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4f9kb_
  • Chain 'C':
    Compound: cAMP-dependent protein kinase type I-beta regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4f9kc_
  • Chain 'D':
    Compound: cAMP-dependent protein kinase type I-beta regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4f9kd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4f9kA (A:)
msglndifeaqkiewhehhhhhhenlyfqshmedeslkgcelyvqlhgiqqvlkdcivhl
ciskperpmkflrehfeklekeenrqilarqksns

    Sequence, based on observed residues (ATOM records): (download) 
    >4f9kA (A:)
kgcelyvqlhgiqqvlkdcivhlciskperpmkflrehfeklekeenrqilarqksn

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4f9kB (B:)
msglndifeaqkiewhehhhhhhenlyfqshmedeslkgcelyvqlhgiqqvlkdcivhl
ciskperpmkflrehfeklekeenrqilarqksns

    Sequence, based on observed residues (ATOM records): (download) 
    >4f9kB (B:)
kgcelyvqlhgiqqvlkdcivhlciskperpmkflrehfeklekeenrqilarqksns

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4f9kC (C:)
msglndifeaqkiewhehhhhhhenlyfqshmedeslkgcelyvqlhgiqqvlkdcivhl
ciskperpmkflrehfeklekeenrqilarqksns

    Sequence, based on observed residues (ATOM records): (download) 
    >4f9kC (C:)
kgcelyvqlhgiqqvlkdcivhlciskperpmkflrehfeklekeenrqilarqksns

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >4f9kD (D:)
msglndifeaqkiewhehhhhhhenlyfqshmedeslkgcelyvqlhgiqqvlkdcivhl
ciskperpmkflrehfeklekeenrqilarqksns

    Sequence, based on observed residues (ATOM records): (download) 
    >4f9kD (D:)
kgcelyvqlhgiqqvlkdcivhlciskperpmkflrehfeklekeenrqilarqk