| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) ![]() dimer of identical alpha-hairpin motifs |
| Family a.31.1.0: automated matches [254326] (1 protein) not a true family |
| Protein automated matches [254747] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [256252] (1 PDB entry) |
| Domain d4f9kb_: 4f9k B: [251930] automated match to d3im3a_ |
PDB Entry: 4f9k (more details), 2.8 Å
SCOPe Domain Sequences for d4f9kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f9kb_ a.31.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgcelyvqlhgiqqvlkdcivhlciskperpmkflrehfeklekeenrqilarqksns
Timeline for d4f9kb_: