PDB entry 4f77

View 4f77 on RCSB PDB site
Description: The 8S snRNP Assembly Intermediate
Class: splicing
Keywords: Complex, Assembly Machinery, SPLICING
Deposited on 2012-05-15, released 2013-02-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.234
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: LD23602p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Smn, CG16725, Dmel_CG16725
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: cg10419
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Gem2, CG10419, Dmel_CG10419
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: Icln
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Dmel_CG4924, icln, icln-RA
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPG, PBSCG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f774_
  • Chain 'A':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77a_
  • Chain 'B':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77b_
  • Chain 'C':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPE
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPF, PBSCF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77d_
  • Chain 'E':
    Compound: LD23602p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Smn, CG16725, Dmel_CG16725
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: cg10419
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Gem2, CG10419, Dmel_CG10419
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Icln
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Dmel_CG4924, icln, icln-RA
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPG, PBSCG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77h_
  • Chain 'I':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77i_
  • Chain 'J':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77j_
  • Chain 'K':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPE
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPF, PBSCF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77l_
  • Chain 'M':
    Compound: LD23602p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Smn, CG16725, Dmel_CG16725
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: cg10419
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Gem2, CG10419, Dmel_CG10419
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Icln
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Dmel_CG4924, icln, icln-RA
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPG, PBSCG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77p_
  • Chain 'Q':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77q_
  • Chain 'R':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77r_
  • Chain 'S':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPE
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPF, PBSCF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77t_
  • Chain 'U':
    Compound: LD23602p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Smn, CG16725, Dmel_CG16725
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: cg10419
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Gem2, CG10419, Dmel_CG10419
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Icln
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Dmel_CG4924, icln, icln-RA
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPG, PBSCG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77x_
  • Chain 'Y':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77y_
  • Chain 'Z':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77z_
  • Chain 'a':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPE
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPF, PBSCF
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: LD23602p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Smn, CG16725, Dmel_CG16725
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: cg10419
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Gem2, CG10419, Dmel_CG10419
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Icln
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Dmel_CG4924, icln, icln-RA
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPG, PBSCG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77f_
  • Chain 'g':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77g_
  • Chain 'h':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD2
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPE
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPF, PBSCF
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: LD23602p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Smn, CG16725, Dmel_CG16725
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: cg10419
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Gem2, CG10419, Dmel_CG10419
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Icln
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Dmel_CG4924, icln, icln-RA
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPG, PBSCG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77n_
  • Chain 'o':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77o_
  • Chain 'p':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD2
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPE
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPF, PBSCF
    Database cross-references and differences (RAF-indexed):
  • Chain 's':
    Compound: LD23602p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Smn, CG16725, Dmel_CG16725
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: cg10419
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Gem2, CG10419, Dmel_CG10419
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: Icln
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Dmel_CG4924, icln, icln-RA
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPG, PBSCG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77v_
  • Chain 'w':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f77w_
  • Chain 'x':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD2
    Database cross-references and differences (RAF-indexed):
  • Chain 'y':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPE
    Database cross-references and differences (RAF-indexed):
  • Chain 'z':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPF, PBSCF
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain '3':
    No sequence available.

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >4f774 (4:)
    mskahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmv
    virgnsiimlealerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f774 (4:)
    hppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirg
    nsiimleale
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f77A (A:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvdvepkvkskkreavagrgrgrgrgrgrgrgrgrggprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77A (A:)
    klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
    gnniryfilpdslpldtllvdv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f77B (B:)
    msllnkpksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafd
    rhcnmvlenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77B (B:)
    pksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmv
    lenvkemwtevpvnkdryiskmflrgdsvivvlrnpliag
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4f77D (D:)
    mslplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlg
    evlircnnvlyirgveeeeedgemre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77D (D:)
    npkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgevlir
    cnnvlyirgve
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4f77H (H:)
    mskahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmv
    virgnsiimlealerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77H (H:)
    hppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirg
    nsiimleale
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4f77I (I:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvdvepkvkskkreavagrgrgrgrgrgrgrgrgrggprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77I (I:)
    klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
    gnniryfilpdslpldtllvdv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4f77J (J:)
    msllnkpksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafd
    rhcnmvlenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77J (J:)
    pksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmv
    lenvkemwtevpvnkdryiskmflrgdsvivvlrnpliag
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4f77L (L:)
    mslplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlg
    evlircnnvlyirgveeeeedgemre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77L (L:)
    npkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgevlir
    cnnvlyirgve
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4f77P (P:)
    mskahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmv
    virgnsiimlealerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77P (P:)
    hppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirg
    nsiimleale
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4f77Q (Q:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvdvepkvkskkreavagrgrgrgrgrgrgrgrgrggprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77Q (Q:)
    klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
    gnniryfilpdslpldtllvdv
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4f77R (R:)
    msllnkpksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafd
    rhcnmvlenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77R (R:)
    pksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmv
    lenvkemwtevpvnkdryiskmflrgdsvivvlrnpliag
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4f77T (T:)
    mslplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlg
    evlircnnvlyirgveeeeedgemre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77T (T:)
    npkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgevlir
    cnnvlyirgve
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4f77X (X:)
    mskahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmv
    virgnsiimlealerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77X (X:)
    hppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirg
    nsiimleale
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >4f77Y (Y:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvdvepkvkskkreavagrgrgrgrgrgrgrgrgrggprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77Y (Y:)
    klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
    gnniryfilpdslpldtllvdv
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >4f77Z (Z:)
    msllnkpksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafd
    rhcnmvlenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77Z (Z:)
    pksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmv
    lenvkemwtevpvnkdryiskmflrgdsvivvlrnpliag
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    Sequence, based on SEQRES records: (download)
    >4f77f (f:)
    mskahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmv
    virgnsiimlealerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77f (f:)
    hppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirg
    nsiimleale
    

  • Chain 'g':
    Sequence, based on SEQRES records: (download)
    >4f77g (g:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvdvepkvkskkreavagrgrgrgrgrgrgrgrgrggprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77g (g:)
    klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
    gnniryfilpdslpldtllvdv
    

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'n':
    Sequence, based on SEQRES records: (download)
    >4f77n (n:)
    mskahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmv
    virgnsiimlealerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77n (n:)
    hppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirg
    nsiimleale
    

  • Chain 'o':
    Sequence, based on SEQRES records: (download)
    >4f77o (o:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvdvepkvkskkreavagrgrgrgrgrgrgrgrgrggprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77o (o:)
    klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
    gnniryfilpdslpldtllvdv
    

  • Chain 'p':
    No sequence available.

  • Chain 'q':
    No sequence available.

  • Chain 'r':
    No sequence available.

  • Chain 's':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'u':
    No sequence available.

  • Chain 'v':
    Sequence, based on SEQRES records: (download)
    >4f77v (v:)
    mskahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmv
    virgnsiimlealerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77v (v:)
    hppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirg
    nsiimleale
    

  • Chain 'w':
    Sequence, based on SEQRES records: (download)
    >4f77w (w:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvdvepkvkskkreavagrgrgrgrgrgrgrgrgrggprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f77w (w:)
    klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
    gnniryfilpdslpldtllvdv
    

  • Chain 'x':
    No sequence available.

  • Chain 'y':
    No sequence available.

  • Chain 'z':
    No sequence available.