PDB entry 4f3j

View 4f3j on RCSB PDB site
Description: Crystal Structure of Trimeric gC1q Domain of Human C1QTNF5 associated with Late-onset Retinal Macular Degeneration
Class: signaling protein
Keywords: Late-onset Retinal Macular Degeneration, L-ORMD, L-ORD, AMD, age-related macular degeneration, C1QTNF5, CTRP5, S163R, Ser163Arg, drusen, retinal deposites, 10-strand jelly-roll fold, MFRP, RPE, ciliary body, SIGNALING PROTEIN
Deposited on 2012-05-09, released 2012-11-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.138
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Complement C1q tumor necrosis factor-related protein 5
  Species: Homo sapiens [TaxId:9606]
  Gene: C1QTNF5, CTRP5, UNQ303/PRO344
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BXJ0 (1-141)
    • expression tag (0)
    • expression tag (142)
  Domains in SCOPe 2.02: d4f3ja_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4f3jA (A:)
  arsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyr
  aslqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasi
  ktdstfsgflvysdwhsspvfahhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4f3jA (A:)
  arsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyr
  aslqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasi
  ktdstfsgflvysdwhsspvfah