PDB entry 4esp

View 4esp on RCSB PDB site
Description: Crystal Structure of Peanut Allergen Ara h 5
Class: allergen
Keywords: peanut allergen, allergy, ara h 5, profilin, ALLERGEN
Deposited on 2012-04-23, released 2013-03-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.169
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Profilin
    Species: Arachis hypogaea [TaxId:3818]
    Gene: profilin
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3K177 (0-129)
      • conflict (7)
      • conflict (79)
      • conflict (119)
    Domains in SCOPe 2.02: d4espa_
  • Heterogens: EDO, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4espA (A:)
    swqtyvddhllceiegnhlssaailgqdgsvwaqssnfpqfkpeeitaimndfaepgsla
    ptglylggtkymviqgepgtvirgkkgpggvtikktnqaliigiydepmtpgqcnmivek
    lgdylidtgl