PDB entry 4eq1

View 4eq1 on RCSB PDB site
Description: Crystal Structure of the ARNT PAS-B homodimer
Class: transcription
Keywords: Per-ARNT-Sim, transcription regulation, homodimer, transcription factor, DNA-binding, HIF1, HIF2, Ahr, TRANSCRIPTION
Deposited on 2012-04-17, released 2013-04-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.203
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Aryl hydrocarbon receptor nuclear translocator
  Species: Homo sapiens [TaxId:9606]
  Gene: ARNT, BHLHE2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P27540 (1-108)
    • expression tag (0)
  Domains in SCOPe 2.02: d4eq1a_
• Chain 'B':
  Compound: Aryl hydrocarbon receptor nuclear translocator
  Species: Homo sapiens [TaxId:9606]
  Gene: ARNT, BHLHE2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P27540 (1-108)
    • expression tag (0)
• Heterogens: PE5, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4eq1A (A:)
  gvcqptefisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqv
  vklkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnv
  

  
  
• Chain 'B':
  No sequence available.