PDB entry 4eok

View 4eok on RCSB PDB site
Description: Thr 160 phosphorylated CDK2 H84S, Q85M, K89D - human cyclin A3 complex with the inhibitor NU6102
Class: Transferase/Transferase Inhibitor
Keywords: protein kinase, cell cycle, PHOSPHORYLATION, Transferase-Transferase Inhibitor complex
Deposited on 2012-04-14, released 2013-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (3-299)
      • expression tag (2)
      • engineered mutation (86-87)
      • engineered mutation (91)
    Domains in SCOPe 2.06: d4eoka1, d4eoka2
  • Chain 'B':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNA2, CCN1, CCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eokb1, d4eokb2
  • Chain 'C':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (3-299)
      • expression tag (0-2)
      • engineered mutation (86-87)
      • engineered mutation (91)
    Domains in SCOPe 2.06: d4eokc1, d4eokc2
  • Chain 'D':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNA2, CCN1, CCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eokd1, d4eokd2
  • Heterogens: 4SP, SGM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eokA (A:)
    lgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllke
    lnhpnivklldvihtenklylvfeflsmdlkdfmdasaltgiplpliksylfqllqglaf
    chshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgc
    kyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdyk
    psfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eokA (A:)
    smenfqkvekigegtygvvykarnkltgevvalkkirlegvpstaireisllkelnhpni
    vklldvihtenklylvfeflsmdlkdfmdasaltgiplpliksylfqllqglafchshrv
    lhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyysta
    vdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkw
    arqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eokB (B:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetlnl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eokC (C:)
    lgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllke
    lnhpnivklldvihtenklylvfeflsmdlkdfmdasaltgiplpliksylfqllqglaf
    chshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgc
    kyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdyk
    psfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4eokD (D:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eokD (D:)
    pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
    vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
    hlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsvi
    agaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekykn
    skyhgvsllnppetln