PDB entry 4egu

View 4egu on RCSB PDB site
Description: 0.95A Resolution Structure of a Histidine Triad Protein from Clostridium difficile
Class: structural genomics, unknown function
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, HIT domain, UNKNOWN FUNCTION
Deposited on 2012-04-01, released 2012-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.137
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine triad (HIT) protein
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD630_24470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q182D4 (3-118)
      • expression tag (1-2)
    Domains in SCOPe 2.08: d4egua1, d4egua2
  • Chain 'B':
    Compound: Histidine triad (HIT) protein
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD630_24470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q182D4 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d4egub1, d4egub2
  • Heterogens: 5GP, ZN, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4eguA (A:)
mermdcifckiangeipstkvyeddrvlafndlnpvapyhilvvpkkhydslidipdkem
divshihvvinkiakekgfdqtgfrvinncgsdggqevkhlhyhilagkklpnyeagqn

    Sequence, based on observed residues (ATOM records): (download) 
    >4eguA (A:)
ermdcifckiangeipstkvyeddrvlafndlnpvapyhilvvpkkhydslidipdkemd
ivshihvvinkiakekgfdqtgfrvinncgsdggqevkhlhyhilagkklpnyeagqn

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4eguB (B:)
mermdcifckiangeipstkvyeddrvlafndlnpvapyhilvvpkkhydslidipdkem
divshihvvinkiakekgfdqtgfrvinncgsdggqevkhlhyhilagkklpnyeagqn

    Sequence, based on observed residues (ATOM records): (download) 
    >4eguB (B:)
mermdcifckiangeipstkvyeddrvlafndlnpvapyhilvvpkkhydslidipdkem
divshihvvinkiakekgfdqtgfrvinncgsdggqevkhlhyhilagkklpnye