Lineage for d4egua1 (4egu A:4-119)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929994Family d.13.1.0: automated matches [191614] (1 protein)
    not a true family
  6. 2929995Protein automated matches [191122] (10 species)
    not a true protein
  7. 2930001Species Clostridium difficile [TaxId:272563] [195574] (1 PDB entry)
  8. 2930002Domain d4egua1: 4egu A:4-119 [195575]
    Other proteins in same PDB: d4egua2, d4egub2
    automated match to d3oxka_
    complexed with 5gp, k, zn

Details for d4egua1

PDB Entry: 4egu (more details), 0.95 Å

PDB Description: 0.95A Resolution Structure of a Histidine Triad Protein from Clostridium difficile
PDB Compounds: (A:) Histidine triad (HIT) protein

SCOPe Domain Sequences for d4egua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4egua1 d.13.1.0 (A:4-119) automated matches {Clostridium difficile [TaxId: 272563]}
mdcifckiangeipstkvyeddrvlafndlnpvapyhilvvpkkhydslidipdkemdiv
shihvvinkiakekgfdqtgfrvinncgsdggqevkhlhyhilagkklpnyeagqn

SCOPe Domain Coordinates for d4egua1:

Click to download the PDB-style file with coordinates for d4egua1.
(The format of our PDB-style files is described here.)

Timeline for d4egua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4egua2