SCOPe 2.07: Structural Classification of Proteins

PDB entry 4e2s

View 4e2s on RCSB PDB site
Description: Crystal structure of (S)-Ureidoglycine Aminohydrolase from Arabidopsis thaliana in complex with its substrate, (S)-Ureidoglycine
Class: hydrolase
Keywords: bi-cupin, (S)-Ureidoglycine Aminohydrolase, Manganese Binding, Endoplasmic Reticulumn, HYDROLASE
Deposited on 2012-03-09, released 2012-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2sa_
Chain 'B':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2sb_
Chain 'C':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2sc_
Chain 'D':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2sd_
Chain 'E':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2se_
Chain 'F':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2sf_
Chain 'G':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2sg_
Chain 'H':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2sh_
Chain 'I':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2si_
Chain 'J':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2sj_
Chain 'K':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2sk_
Chain 'L':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2sl_
Chain 'M':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2sm_
Chain 'N':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2sn_
Chain 'O':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2so_
Chain 'P':
Compound: Ureidoglycine aminohydrolase
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ylbA, UGLYAH, At4g17050, AT4G17050
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GXV5 (Start-265)
Domains in SCOPe 2.07: d4e2sp_
Heterogens: MN, UGY, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4e2sA (A:)
ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
vpqwyaalgktrsryllykdvnrnpl