PDB entry 4dww

View 4dww on RCSB PDB site
Description: Crystal Structure of Nattokinase from Bacillus subtilis natto
Class: hydrolase
Keywords: Fibrinolytic activity, HYDROLASE
Deposited on 2012-02-27, released 2012-03-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.137
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Subtilisin NAT
    Species: Bacillus subtilis subsp. natto [TaxId:86029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4dwwa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4dwwA (A:)
aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
vinmslggptgstalktvvdkavssgivvaaaagnegssgststvgypakypstiavgav
nssnqrasfssvgseldvmapgvsiqstlpggtygayngtsmatphvagaaalilskhpt
wtnaqvrdrlestatylgnsfyygkglinvqaaaq